Gene : AT2G39970

Symbol :	AT2G39970
Name/description :	peroxisomal membrane protein (PMP36)
Synonyms :	T28M21.13, T28M21_13
Organism :	Arabidopsis thaliana
Peroxisomal Localization :	GO: peroxisomal membrane Y Fukao, et al.2001. Plant Cell Physiol. GFP: No experiment found Mass Spectrometry: Holger Eubel, et al.2008. Plant Physiol. PeroxisomeDB annotation
Protein family :	ANT
Protein consensus sequence :	MSDALINGLAGAGGGIIAQLLTYPLQTVNTRQQTERDLKREKRKLGTIEHMCQVVKQEGWERLYGGLAPSLAGTAASQGVYYYFYQVFRNRAEATALARKKKGLGDGSVGMFASLLVAAFAGSVNVLMTNPIWVIVTRMQTHRKMTKDQTAAPESPSSNAEALVAVEPRPYGTFNTIREVYDEAGITGFWKGVIPTLIMVSNPSMQFMLYETMLTKLKKKRALKGSNNVTALETFLLGAVAKLGATVTTYPLLVVKSRLQAKQVTTGDKRQQYKGTLDAILKMIRYEGLYGFYKGMSTKIVQSVLAAAVLFMIKEELVKGAKLLLSNATSS
Functional category(ies) :	Peroxisomal membrane proteins (PMP) PXMP 34 family proteins
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help]
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Nicole Linka, et al.2008. Plant Cell Peroxisomal ATP import is essential for seedling development in Arabidopsis thaliana. Yuko Arai, et al.2008. Plant Cell Proteomic identification and characterization of a novel peroxisomal adenine nucleotide transporter supplying ATP for fatty acid beta-oxidation in soybean and Arabidopsis. Y Fukao, et al.2001. Plant Cell Physiol. Developmental analysis of a putative ATP/ADP carrier protein localized on glyoxysomal membranes during the peroxisome transition in pumpkin cotyledons.