Gene : CSY3

Symbol :	CSY3
Name/description :	CSY3 (citrate synthase 3); citrate (SI)-synthase
Synonyms :	citrate synthase 3, CSY3, F7D19.21, F7D19_21
Organism :	Arabidopsis thaliana
Peroxisomal Localization :	GO: peroxisome Sigrun Reumann, et al.2007. Plant Cell GFP: No experiment found Mass Spectrometry: Holger Eubel, et al.2008. Plant Physiol. PeroxisomeDB annotation
Protein family :	CS
Protein consensus sequence :	PTS2=3.9e-005; start position=10; end position=18; MEISERVRARLAVLSGHLSEGKQDSPAIERWCTSADTSVAPLGSLKGTLTIVDERTGKNYKVPVSDDGTVKAVDFKKIVTGKEDKGLKLYDPGYLNTAPVRSSISYIDGDEGILRYRGYPIEEMAENSTFLEVAYLLMYGNLPSESQLSDWEFAVSQHSAVPQGVLDIIQSMPHDAHPMGVLVSAMSALSIFHPDANPALRGQDIYDSKQVRDKQIIRIIGKAPTIAAAAYLRMAGRPPVLPSGNLPYADNFLYMLDSLGNRSYKPNPRLARVLDILFILHAEHEMNCSTAAARHLASSGVDVYTAVAGAVGALYGPLHGGANEAVLKMLSEIGTVENIPEFIEGVKNRKRKMSGFGHRVYKNYDPRAKVIKNLADEVFSIVGKDPLIEVAVALEKAALSDDYFVKRKLYPNVDFYSGLIYRAMGFPPEFFTVLFAIPRMAGYLSHWKESLDDPDTKIMRPQQVYTGVWLRHYTPVRERIVTDDSKESDKLGQVATSNASRRRLAGSSV
Functional category(ies) :	Carbohydrate Metabolism Glyoxylate and dicarboxylate metabolism
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Itsara Pracharoenwattana, et al.2005. Plant Cell Arabidopsis peroxisomal citrate synthase is required for fatty acid respiration and seed germination. A Kato, et al.2000. Cell Biochem. Biophys. Transport of peroxisomal proteins synthesized as large precursors in plants. A Kato, et al.1999. Plant Cell Physiol. Oligomeric proteins containing N-terminal targeting signals are imported into peroxisomes in transgenic Arabidopsis. A Kato, et al.1998. Plant Cell Physiol. Glyoxysomal malate dehydrogenase in pumpkin: cloning of a cDNA and functional analysis of its presequence. A Kato, et al.1996. Plant Cell Targeting and processing of a chimeric protein with the N-terminal presequence of the precursor to glyoxysomal citrate synthase.