Gene : ATMDAR1

Symbol :	ATMDAR1
Name/description :	monodehydroascorbate reductase, putative
Synonyms :	monodehydroascorbate reductase 1
Organism :	Arabidopsis thaliana
Peroxisomal Localization :	GO: peroxisome Lisenbee Lisenbee, et al.2005. Plant J. Sigrun Reumann, et al.2007. Plant Cell GFP: No experiment found Mass Spectrometry: Holger Eubel, et al.2008. Plant Physiol. PeroxisomeDB annotation
Protein family :	MDAR
Protein consensus sequence :	MAEKSFKYIILGGGVSAGYAAKEFANQGVQPGELAVISKEAVAPYERPALSKGYLFPEGAARLPGFHCCVGSGGEKLLPESYKQKGIELILSTEIVKADLSAKSLVSATGDVFKYQTLIIATGSTVLRLTDFGVKGADSKNILYLREIDDADKLVEAIKAKKGGKAVVVGGGYIGLELSAVLRINNLDVTMVFPEPWCMPRLFTADIAAFYETYYTNKGVKIIKGTVASGFTAQPNGEVKEVQLKDGRTLEADIVIVGVGAKPLTSLFKGQVEEDKGGIKTDAFFKTSVPDVYAVGDVATFPLKMYGDVRRVEHVDHSRKSAEQAVKAIKAAEGGAAVEEYDYLPFFYSRSFDLSWQFYGDNVGDSVLFGDSNPSNPKPRFGAYWVQGGKVVGAFMEGGSGDENKALAKVAKARPSAESLDELVKQGISFAAKI
Functional category(ies) :	Antioxidant Metabolism
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Eastmond Eastmond, et al.2007. Plant Cell MONODEHYROASCORBATE REDUCTASE4 is required for seed storage oil hydrolysis and postgerminative growth in Arabidopsis. Lisenbee Lisenbee, et al.2005. Plant J. Arabidopsis peroxisomes possess functionally redundant membrane and matrix isoforms of monodehydroascorbate reductase.