Gene : AT4G05160

Symbol :	AT4G05160
Name/description :	4-coumarate--CoA ligase, putative / 4-coumaroyl-CoA synthase, putative
Synonyms :	C17L7.80, C17L7_80
Organism :	Arabidopsis thaliana
Peroxisomal Localization :	GO: peroxisome Sigrun Reumann, et al.2007. Plant Cell GFP: No experiment found Mass Spectrometry: Holger Eubel, et al.2008. Plant Physiol. PeroxisomeDB annotation
Protein family :	FACL
Protein consensus sequence :	PTS1=0.003; start position=533; end position=544; MEKSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLAIADSDTGDSLTFSQLKSAVARLAHGFHRLGIRKNDVVLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEVSKQIKDSNPKIIISVNQLFDKIKGFDLPVVLLGSKDTVEIPPGSNSKILSFDNVMELSEPVSEYPFVEIKQSDTAALLYSSGTTGTSKGVELTHGNFIAASLMVTMDQDLMGEYHGVFLCFLPMFHVFGLAVITYSQLQRGNALVSMARFELELVLKNIEKFRVTHLWVVPPVFLALSKQSIVKKFDLSSLKYIGSGAAPLGKDLMEECGRNIPNVLLMQGYGMTETCGIVSVEDPRLGKRNSGSAGMLAPGVEAQIVSVETGKSQPPNQQGEIWVRGPNMMKGYLNNPQATKETIDKKSWVHTGDLGYFNEDGNLYVVDRIKELIKYKGFQVAPAELEGLLVSHPDILDAVVIPFPDEEAGEVPIAFVVRSPNSSITEQDIQKFIAKQVAPYKRLRRVSFISLVPKSAAGKILRRELVQQVRSKM
Functional category(ies) :	Lipid metabolism Long/very long fatty acids activation
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Wenxu Wiszniewski, et al.2009. Plant Mol. Biol. Identification of two Arabidopsis genes encoding a peroxisomal oxidoreductase-like protein and an acyl-CoA synthetase-like protein that are required for responses to pro-auxins. Lucie Kienow, et al.2008. J. Exp. Bot. Jasmonates meet fatty acids: functional analysis of a new acyl-coenzyme A synthetase family from Arabidopsis thaliana. Karen Turner, et al.2005. J. Biol. Chem. Characterization of Arabidopsis fluoroacetate-resistant mutants reveals the principal mechanism of acetate activation for entry into the glyoxylate cycle. Martin Fulda, et al.2004. Plant Cell Peroxisomal Acyl-CoA synthetase activity is essential for seedling development in Arabidopsis thaliana. Martin Fulda, et al.2002. Plant J. Two long-chain acyl-CoA synthetases from Arabidopsis thaliana involved in peroxisomal fatty acid beta-oxidation.