Gene : APX3

Symbol :	APX3
Name/description :	APX3 (ASCORBATE PEROXIDASE 3); L-ascorbate peroxidase
Synonyms :	ASCORBATE PEROXIDASE 3, M4E13.60, M4E13_60
Organism :	Arabidopsis thaliana
Peroxisomal Localization :	GO: peroxisome H Zhang, et al.1997. Plant Mol. Biol. Sigrun Reumann, et al.2007. Plant Cell GFP: No experiment found Mass Spectrometry: Holger Eubel, et al.2008. Plant Physiol. Yoichiro Fukao, et al.2003. Plant Cell Physiol. Youichiro Fukao, et al.2002. Plant Cell Physiol. PeroxisomeDB annotation
Protein family :	APX
Protein consensus sequence :	MAAPIVDAEYLKEITKARRELRSLIANKNCAPIMLRLAWHDAGTYDAQSKTGGPNGSIRNEEEHTHGANSGLKIALDLCEGVKAKHPKITYADLYQLAGVVAVEVTGGPDIVFVPGRKDSNVCPKEGRLPDAKQGFQHLRDVFYRMGLSDKDIVALSGGHTLGRAHPERSGFDGPWTQEPLKFDNSYFVELLKGESEGLLKLPTDKTLLEDPEFRRLVELYAKDEDAFFRDYAESHKKLSELGFNPNSSAGKAVADSTILAQSAFGVAVAAAVVAFGYFYEIRKRMK
Functional category(ies) :	Antioxidant Metabolism
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Eastmond Eastmond, et al.2007. Plant Cell MONODEHYROASCORBATE REDUCTASE4 is required for seed storage oil hydrolysis and postgerminative growth in Arabidopsis. Petra Zimmermann, et al.2006. Plant Cell Environ. Senescence-specific regulation of catalases in Arabidopsis thaliana (L.) Heynh. Lisenbee Lisenbee, et al.2005. Plant J. Arabidopsis peroxisomes possess functionally redundant membrane and matrix isoforms of monodehydroascorbate reductase. Irene Murgia, et al.2004. Plant J. Arabidopsis thaliana plants overexpressing thylakoidal ascorbate peroxidase show increased resistance to Paraquat-induced photooxidative stress and to nitric oxide-induced cell death. Mullen Mullen, et al.2001. Trends Plant Sci. How are peroxisomes formed? The role of the endoplasmic reticulum and peroxins.