Gene : PMDH2

Symbol :	PMDH2
Name/description :	PMDH2 (peroxisomal NAD-malate dehydrogenase 2); malate dehydrogenase
Synonyms :	F17I14.150, F17I14_150, peroxisomal NAD-malate dehydrogenase 2, PMDH2
Organism :	Arabidopsis thaliana
Peroxisomal Localization :	GO: peroxisome Sigrun Reumann, et al.2007. Plant Cell GFP: No experiment found Mass Spectrometry: Holger Eubel, et al.2008. Plant Physiol. PeroxisomeDB annotation
Protein family :	MDH
Protein consensus sequence :	MEAKNSVIGRENCRAKGGNPGFKVAILGAAGGIGQSLSLLMKMNPLVSLLHLYDVVNAPGVTADVSHMDTGAVVRGFLGAKQLEDALTGMDLVIIPAGIPRKPGMTRDDLFKINAGIVKTLCEGVAKCCPNAIVNLISNPVNSTVPIAAEVFKKAGTYDPKKLLGVTTLDVARANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQVKPPSSFTPQEIEYLTNRIQNGGTEVVEAKAGAGSATLSMAYAAAKFADACLRGLRGDANVVECSFVASQVTELAFFATKVRLGRTGAEEVYQLGPLNEYERIGLEKAKDELAGSIQKGVEFIRK
Functional category(ies) :	Carbohydrate Metabolism Glyoxylate and dicarboxylate metabolism
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Holger Schuhmann, et al.2008. Plant Physiol. The DEG15 serine protease cleaves peroxisomal targeting signal 2-containing proteins in Arabidopsis. Itsara Cousins, et al.2008. Plant Physiol. Peroxisomal malate dehydrogenase is not essential for photorespiration in Arabidopsis but its absence causes an increase in the stoichiometry of photorespiratory CO2 release. Michael Helm, et al.2007. Proc. Natl. Acad. Sci. U.S.A. Dual specificities of the glyoxysomal/peroxisomal processing protease Deg15 in higher plants. Itsara Pracharoenwattana, et al.2007. Plant J. Arabidopsis peroxisomal malate dehydrogenase functions in beta-oxidation but not in the glyoxylate cycle. A Kato, et al.1998. Plant Cell Physiol. Glyoxysomal malate dehydrogenase in pumpkin: cloning of a cDNA and functional analysis of its presequence.