Gene : CAA36819.1

Symbol :	CAA36819.1
Name/description :	CAA36819.1
Synonyms :
Organism :	Trypanosoma brucei
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	FBPA
Protein consensus sequence :	MSKRVEVLLTQLPAYNRLKTPYEAELIETAKKMTAPGKGLLAADESTGSCSKRFAGIGLSNTAEHRRQYRALMLECEGFEQYISGVILHDETVYQKAKTGETFPQYLRRRGVVPGIKTDCGLEPLVEGAKGEQMTAGLDGYIKRAKKYYAMGCRFCKWRNVYKIQNGTVSEAVVRFNAETLARYAILSQLCGLVPIVEPEVMIDGTHDIETCQRVSQHVWSEVVSALHRHGVVWEGCLLKPNMVVPGAESGLKGHAEQVAEYTVKTLARVIPPALPGVTFLSGGLSEVMASEYLNAMNNCPLPRPWKLTFSYARALQSSAIKRWGGKESGVEAGRRAFMHRAKMNSLAQLGKYNRADDDKDSQSLYVAGNTY
Functional category(ies) :	Carbohydrate Metabolism Glycolysis and biosynthesis of sugar nucleotides
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help]
Gene Info:	No banks found
Pubmed:	Veronique Hannaert, et al.2003. Proc. Natl. Acad. Sci. U.S.A. Plant-like traits associated with metabolism of Trypanosoma parasites. S Chudzik, et al.2000. J. Mol. Biol. Structures of type 2 peroxisomal targeting signals in two trypanosomatid aldolases. J Blattner, et al.1995. FEBS Lett. Function of N-terminal import signals in trypanosome microbodies. Clayton Clayton, et al.1987. J. Cell Biol. Import of fructose bisphosphate aldolase into the glycosomes of Trypanosoma brucei.