Gene : CAGL0H06787g

Symbol :	CAGL0H06787g
Name/description :	hypothetical protein
Synonyms :
Organism :	Candida glabrata
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	ACAA1
Protein consensus sequence :	MAERLKNIGSHLLGGSQGPSVKEQHPDDVVIVAANRSAIAKGFKGSFKDVNTDYLLTVFLKEFIDTFPPQLRDNLDLIGEVTCGNVLNPGAGATEHRGAMLAAGLPYTTPFMALNRQCSSGLTAVNDIANKIKAGQIDVGLAAGVESMTQNYASSNPLGRISDELKSDKNARKCLIPMGITNENIAKGFEITREMQDEFAAASYQKASNAVQSGVFKDEILPITLPDGKVVDVDEGPRANVTAKSLGGLKPAFIKETGTTTAGNASQVSDGVAGVLLARRSVANKLKLPILGRYVAFQSVGVPPEIMGVGPAYAIPRVLQDVGITVDDVDVFEINEAFAAQALYCINKLGINLKKVNPRGGAIALGHPLGCTGARQIATILRELEKGQVGVVSMCIGTGMGAAAVFVKE
Functional category(ies) :	Fatty acid oxidation Long-chain dicarboxylic acids oxidation Straight chain fatty acids beta-oxidation Straight chain fatty acids oxidation
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help] Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Mitsuyoshi Ueda, et al.2003. Biochim. Biophys. Acta Up-regulation of the peroxisomal beta-oxidation system occurs in butyrate-grown Candida tropicalis following disruption of the gene encoding peroxisomal 3-ketoacyl-CoA thiolase. T Kanai, et al.2000. J. Bacteriol. An n-alkane-responsive promoter element found in the gene encoding the peroxisomal protein of Candida tropicalis does not contain a C(6) zinc cluster DNA-binding motif. N Kanayama, et al.1998. J. Bacteriol. Genetic evaluation of physiological functions of thiolase isoenzymes in the n-alkalane-assimilating yeast Candida tropicalis. T Kurihara, et al.1992. J. Biochem. Physiological roles of acetoacetyl-CoA thiolase in n-alkane-utilizable yeast, Candida tropicalis: possible contribution to alkane degradation and sterol biosynthesis. T Kurihara, et al.1989. J. Biochem. Peroxisomal acetoacetyl-CoA thiolase and 3-ketoacyl-CoA thiolase from an n-alkane-utilizing yeast, Candida tropicalis: purification and characterization.