Gene : YALI0E16599g

Symbol :	YALI0E16599g
Name/description :	YALI0E16599p
Synonyms :
Organism :	Yarrowia lipolytica
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX16
Protein consensus sequence :	MTDKLVKVMQKKKSAPQTWLDSYDKFLVRNAASIGSIESTLRTVSYVLPGRFNDVEIATETLYAVLNVLGLYHDTIIARAVAASPNAAAVYRPSPHNRYTDWFIKNRKGYKYASRAVTFVKFGELVAEMVAKKNGGEMARWKCIIGIEGIKAGLRIYMLGSTLYQPLCTTPYPDREVTGELLETICRDEGELDIEKGLMDPQWKMPRTGRTIPEIAPTNVEGYLLTKVLRSEDVDRPYNLLSRLDNWGVVAELLSILRPLIYACLLFRQHVNKTVPASTKSKFPFLNSPWAPWIIGLVIEALSRKMMGSWLLRQRQSGKTPTALDQMEVKGRTNLLGWWLFRGEFYQAYTRPLLYSIVARLEKIPGLGLFGALISDYLYLFDRYYFTASTL
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome membrane assembly
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help]
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Tong Guo, et al.2007. J. Cell Biol. A signal from inside the peroxisome initiates its division by promoting the remodeling of the peroxisomal membrane. Y Lin, et al.1999. Science The Pex16p homolog SSE1 and storage organelle formation in Arabidopsis seeds. M Honsho, et al.1998. Am. J. Hum. Genet. Mutation in PEX16 is causal in the peroxisome-deficient Zellweger syndrome of complementation group D. Titorenko Titorenko, et al.1998. Mol. Cell. Biol. Mutants of the yeast Yarrowia lipolytica defective in protein exit from the endoplasmic reticulum are also defective in peroxisome biogenesis. Eitzen Eitzen, et al.1997. J. Cell Biol. Enlarged peroxisomes are present in oleic acid-grown Yarrowia lipolytica overexpressing the PEX16 gene encoding an intraperoxisomal peripheral membrane peroxin.