Gene : YALI0C04092g

Symbol :	YALI0C04092g
Name/description :	YALI0C04092p
Synonyms :
Organism :	Yarrowia lipolytica
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX11
Protein consensus sequence :	MSVCLAQNPTVTRVVKLLETHVGRDKILRSIQYFSRFLTYYLFRKGYTKDTIDIFRKIQNQFSMARKLFRVGKPIGHLKTAAVSFENKTLDPCLRYTTIGRNLGYAIYLVFDSIIYINGSGIKKIDNIKTIKKVGSYFWAFGIFCNILNSIHKINICKKKRAALAAEKEKDTTSAKKNDKDAAAAQKQLVWDLLDFSIPLTSLGYLHLDDGLVGLAGFATGIMGVQKAWAATA
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome division-proliferation
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help]
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Vizeacoumar Vizeacoumar, et al.2003. J. Cell Biol. YHR150w and YDR479c encode peroxisomal integral membrane proteins involved in the regulation of peroxisome number, size, and distribution in Saccharomyces cerevisiae.