Gene : DDB_0231470

Symbol :	DDB_0231470
Name/description :	urate oxidase
Synonyms :
Organism :	Dictyostelium discoideum
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	UOX
Protein consensus sequence :	MATLIDNRYGKARVRVLRVFKGPNEYHKVFDFDCRVLLRGAEFSETYLTGDNSKVVATDTMKNTVYVIAQKEEFKSLEEYGILLGKHFLATYSWVNGVEVVMRENQWRRIKTSNGKEQAHSFQRDREIHSVTVTSSRDKSPVVVSGIDDLLIMKTTQSGFEGFHRDKYTSLKETKDRVFATVVTANWTYNTLSVDYSKVFEQFKLSVFDIFAQTYSRSVQETLFLIAKDVISKVPQVEQVHLSLPNKHAFGFDFSRLNIENNQTVFQPVEEPSGLIEGTIKRSHSRL*
Functional category(ies) :	Metabolism Purines and pyrimidines
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help] Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	H Hayashi, et al.1978. J. Biochem. Some characteristics of peroxisomes in the slime mold, Dictyostelium discoideum. Parish Parish, et al.1975. Eur. J. Biochem. Mitochondria and peroxisomes from the cellular slime mould Dictyostelium discoideum. Isolation techniques and urate oxidase association with peroxisomes.