Gene : Tc00.1047053511181.90

Symbol :	Tc00.1047053511181.90
Name/description :	peroxisome targeting signal 1 receptor
Synonyms :
Organism :	Trypanosoma cruzi
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX5
Protein consensus sequence :	MDCSTGAAIGQQFAKDAFHMHGGVGVGPTGNPEHDVLMNEMMMVQTPTGPAGEWTHQFAAYQGKQQQQHPQELAMRHQQNDALMLRQQQEMEEAFCTLCAAHPHSHAHSHAHSHQPQGLVGPAMMGPQIMPPMMFGPGSGGFMMGTPPMMPYASMKFAGDAAMAAANNTTMTQGATATSTTSVQQEQQQQQSSDNGWVEKLRDAEWAQDYSDAQVFTLEGQSEQTMEEHAKNSEFYQFMDKIRSKELLIDEETGQLVQGPGPDPDAPEDAEYLKEWAAAEGLNMPPGFFEHMMQRPQGNNEQAEGRLFDGSNDALMDDGALDNAADVEEWAREYAEAQEQLQRVQNETNYPFEPNNPYMYHDKPMEEGIAMLQLANMAEAALAFEAVCQKEPENVEAWRRLGTTQAENEKDCLAIIALNHARMLDPKDIAVHAALAVSHTNEHNVGAALQSLRSWLLSQPQYEHLGLVDLQEVAADEGLDEVPEENYFFAAPSEYRDCCTLLYAAVEMNPNDPQLHASLGVLHNLSHRFDEAAKNFRRAVELRPDDAHTWNKLGATLANGNRPQEALEAYNRALDINPGYVRVMYNMAVSYSNMAQYPLAAKHITRAIALQAGGTNPQGEGSRIATRGLWDLLRMTLNLMDRSDLVEASWQQDLTPFLKEFGLEDMAV
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome targeting sequence binding
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help]
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Emilie Verplaetse, et al.2009. Biochim. Biophys. Acta Identification, characterization and essentiality of the unusual peroxin 13 from Trypanosoma brucei. Parthasarathy Sampathkumar, et al.2008. J. Mol. Biol. Structural insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5. Nathalie Galland, et al.2007. Biochim. Biophys. Acta Characterization of the role of the receptors PEX5 and PEX7 in the import of proteins into glycosomes of Trypanosoma brucei. A Kumar, et al.2001. J. Mol. Biol. An unexpected extended conformation for the third TPR motif of the peroxin PEX5 from Trypanosoma brucei. A Jardim, et al.2000. J. Biol. Chem. Peroxisomal targeting signal-1 receptor protein PEX5 from Leishmania donovani. Molecular, biochemical, and immunocytochemical characterization.