Gene : Tc00.1047053508479.230

Symbol :	Tc00.1047053508479.230
Name/description :	peroxin-2
Synonyms :
Organism :	Trypanosoma cruzi
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX2
Protein consensus sequence :	MSWVVDSAGAQFPLAMVMKQQGALPTSQTFTALPENHVLRVFQLGALQTQAELVDILRSSLFDIFDLDALQSYRYAYQDELVFFLDVILYWGSTWRRSQSIGDRLGNIVMRDETKALENGQSSVVRLVPSLAPTRGRLLVHAILTILVPYLVRKLQRKSMEEDWEGESPGSLRARVAKTIRLASTAWAAFSLLHTLHFLATAQYRTLVERLLSLRLVYGSQSTQRVTNLMYLNQHVMWQTWSSFLAVLNIGRYLSRLTRSLQAFTSPSGSLTLGDNVCCACHSHPTIGQRSNCGHLYCYYCIKSRLLDPRLAGSFRCLRCGTTVHTAFPLQ
Functional category(ies) :	ZN RING proteins
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help]
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Tracy Saveria, et al.2007. Exp. Parasitol. Characterization of glycosomal RING finger proteins of trypanosomatids. Tracy Banerjee, et al.2005. Mol. Biochem. Parasitol. Identification of trypanosomatid PEX19: functional characterization reveals impact on cell growth and glycosome size and number. Cristina Guerra-Giraldez, et al.2002. J. Cell. Sci. Compartmentation of enzymes in a microbody, the glycosome, is essential in Trypanosoma brucei.