Gene : ACAA1

Symbol :	ACAA1
Name/description :	acetyl-Coenzyme A acyltransferase 1
Synonyms :	ACAA, THIO, PTHIO
Organism :	Homo sapiens
Peroxisomal Localization :	GO: peroxisome A Bout, et al.1991. Biochim. Biophys. Acta GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	ACAA1
Protein consensus sequence :	PTS2=1.6e-008; start position=3; end position=11; MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN
Functional category(ies) :	Fatty acid oxidation Fatty acid synthesis/PUFAS synthesis Long-chain dicarboxylic acids oxidation Straight chain fatty acids beta-oxidation Straight chain fatty acids oxidation Unsaturated fatty acid beta-oxidation
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL SNPs (NCBI) Intron/Exon (Ace View: NCBI) Gene Expression (UCSC) Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	S Ferdinandusse, et al.2002. Am. J. Hum. Genet. Reinvestigation of peroxisomal 3-ketoacyl-CoA thiolase deficiency: identification of the true defect at the level of d-bifunctional protein. C Fujiwara, et al.2000. J. Biol. Chem. Catalase-less peroxisomes. Implication in the milder forms of peroxisome biogenesis disorder. T Jiang, et al.1997. J. Biochem. Physiological role of D-3-hydroxyacyl-CoA dehydratase/D-3-hydroxyacyl-CoA dehydrogenase bifunctional protein. A Kamei, et al.1993. J. Pediatr. Peroxisomal disorders in children: immunohistochemistry and neuropathology. A Hughes, et al.1992. Eur. J. Pediatr. Ultrastructure and immunocytochemistry of hepatic peroxisomes in rhizomelic chondrodysplasia punctata. , et al.0. Brain Dev. Prenatal diagnosis of peroxisomal disorders. Biochemical and immunocytochemical studies on peroxisomes in human amniocytes.