Gene : PXMP4

Symbol :	PXMP4
Name/description :	peroxisomal membrane protein 4
Synonyms :	PMP24
Organism :	Homo sapiens
Peroxisomal Localization :	GO: peroxisomal membrane C Reguenga, et al.1999. Biochim. Biophys. Acta GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PXMP4
Protein consensus sequence :	MAAPPQLRALLVVVNALLRKRRYHAALAVLKGFRNGAVYGAKIRAPHALVMTFLFRNGSLQEKLWAILQATYIHSWNLARFVFTYKGLRALQSYIQGKTYPAHAFLAAFLGGILVFGENNNINSQINMYLLSRVLFALSRLAVEKGYIPEPRWDPFPLLTAVVWGLVLWLFEYHRSTLQPSLQSSMTYLYEDSNVWHDISDFLVYNKSRPSN
Functional category(ies) :	Peroxisomal membrane proteins (PMP) PXMP 2/4 family proteins
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL SNPs (NCBI) Intron/Exon (Ace View: NCBI) Gene Expression (UCSC) Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Paolo Lasorsa, et al.2008. J. Biol. Chem. Peroxisomes as novel players in cell calcium homeostasis. Yasuhiko Sato, et al.2008. J. Biol. Chem. Characterization of the interaction between recombinant human peroxin Pex3p and Pex19p: identification of TRP-104 IN Pex3p as a critical residue for the interaction. Luigi Ko, et al.2007. J. Biol. Chem. The sterol carrier protein SCP-x/pro-SCP-2 gene has transcriptional activity and regulates the Alzheimer disease gamma-secretase. João Carvalho, et al.2006. J. Mol. Biol. The N-terminal half of the peroxisomal cycling receptor Pex5p is a natively unfolded domain. R Wightman, et al.2003. Hum. Mutat. MLYCD mutation analysis: evidence for protein mistargeting as a cause of MLYCD deficiency.