Gene : FIS1

Symbol :	FIS1
Name/description :	tetratricopeptide repeat domain 11
Synonyms :	TTC11, CGI-135
Organism :	Homo sapiens
Peroxisomal Localization :	GO: peroxisome Miki Kikuchi, et al.2004. J. Biol. Chem. Annett Koch, et al.2005. Mol. Biol. Cell GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	FIS1
Protein consensus sequence :	MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLALSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATAGALHILAGICGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV
Functional category(ies) :	Peroxisome organization
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL SNPs (NCBI) Intron/Exon (Ace View: NCBI) Gene Expression (UCSC) Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Michael Delille, et al.2008. J. Biol. Chem. Targeting of hFis1 to peroxisomes is mediated by Pex19p. Shinta Kobayashi, et al.2007. Exp. Cell Res. Fis1, DLP1, and Pex11p coordinately regulate peroxisome morphogenesis.