Gene : SOD1

Symbol :	SOD1
Name/description :	superoxide dismutase 1, soluble
Synonyms :	SOD1
Organism :	Macaca mulatta
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	SOD1
Protein consensus sequence :	MAMKAVCVLKGDSPVQGTINFEQKARAGAEALKVWGSITGLTEGLHGFHVHQFGDNTQGCTSAGPHFNPLSRQHGGPKDEERHVGDLGNVTAGKDGVAKVSFEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESKKTGNAGGRLACGVIGIAQ
Functional category(ies) :	Antioxidant Superoxide dismutase
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Z Pardo, et al.1995. Proc. Natl. Acad. Sci. U.S.A. Superoxide dismutase is an abundant component in cell bodies, dendrites, and axons of motor neurons and in a subset of other neurons.