Gene : Pxmp4

Symbol :	Pxmp4
Name/description :	peroxisomal membrane protein 4
Synonyms :	Pmp24, 3010018P03Rik
Organism :	Mus musculus
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: Sebastian Wiese, et al.2007. Mol. Cell PROTEOMICS PeroxisomeDB annotation
Protein family :	PXMP4
Protein consensus sequence :	MAAPPQLQALLQAVNKLLRQRRYHAALAVIKGFRNGAVYGVKIRAPHALVMTFLFRSGSLREKLQAILKATYIHSRNLACFVFAYKSLHALQSHVQGETHQMHSFLAAFIGGLLLFGENNNINSQINMYLTSRVLYALCRLGVEKGYIPALKWDPFPLHTAVIWGLVLWLFEYHRPTLQPSLQSSMTYLYEDSNVWHDLSDFLIFNKSHPSK
Functional category(ies) :	Peroxisomal membrane proteins (PMP) PXMP 2/4 family proteins
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help]
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Zhenzhen Jia, et al.2007. J. Biol. Chem. Fatty acid transport protein 4 is the principal very long chain fatty acyl-CoA synthetase in skin fibroblasts. Henk Keane, et al.2007. Hepatology Bile acid treatment alters hepatic disease and bile acid transport in peroxisome-deficient PEX2 Zellweger mice. Johannes Berger, et al.2006. Biochim. Biophys. Acta X-linked adrenoleukodystrophy: clinical, biochemical and pathogenetic aspects. Tomoko Nagase, et al.2004. Biochim. Biophys. Acta Peroxisomal localization in the developing mouse cerebellum: implications for neuronal abnormalities related to deficiencies in peroxisomes. Ineke Tabak, et al.2003. Traffic Peroxisomes start their life in the endoplasmic reticulum.