Gene : Pex19

Symbol :	Pex19
Name/description :	peroxisomal biogenesis factor 19
Synonyms :	Pxf
Organism :	Mus musculus
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX19
Protein consensus sequence :	MAAAEEGCGVGVEDDRELEELLESALDDFDKAKPSPEHAPTISAPDASGPQKRAPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLSGLAKNATELQNSGMSEEELMKAMEGLGMDEGDGEASILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHQDSTPPEQFEKYQQQHSVMVKICEQFEAETPTDSEATQRARFEAMLDLMQQLQALGHPPKELAGEMPPGLNFDLDALNLSGPPGANGEQCLIM
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome membrane assembly
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help]
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Konstantinos Fletcher, et al.2008. J. Immunol. Congenic analysis of the NKT cell control gene Nkt2 implicates the peroxisomal protein Pxmp4. Ryota Itoh, et al.2006. J. Biol. Chem. Functional domains and dynamic assembly of the peroxin Pex14p, the entry site of matrix proteins. Yoshinori Kashiwayama, et al.2005. Biochim. Biophys. Acta Role of Pex19p in the targeting of PMP70 to peroxisome. K Dunster, et al.2005. Clin. Exp. Immunol. Limkain b1, a novel human autoantigen localized to a subset of ABCD3 and PXF marked peroxisomes. Y Suzuki, et al.2001. J. Inherit. Metab. Dis. Clinical, biochemical and genetic aspects and neuronal migration in peroxisome biogenesis disorders.