| Symbol : |
Mpv17 |
| Name/description : |
Mpv17 transgene, kidney disease mutant |
| Synonyms : |
Tg.Mpv17 |
| Organism : |
|
| Peroxisomal Localization : |
- GO: peroxisome
- GFP: No experiment found
- Mass Spectrometry: No experiment found
- PeroxisomeDB annotation
|
| Protein family : |
|
| Protein consensus sequence : |
MALWRAYQRALAAHPWKVQVLTAGSLMGVGDMISQQLVERRGLQQHQAGRTLTMVSLGCGFVGPVVGGWYKVLDHLIPGTTKVHALKKMLLDQGGFAPCFLGCFLPLVGILNGMSAQDNWAKLKRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAIVWNSYLSWKAHQF |
| Functional category(ies) : |
|
| Disease(s) : |
No diseases found
|
| Comparative genomics: |
|
| Gene Info: |
|
| Pubmed: |
- Reiko Iida, et al.2005. Exp. Cell Res. A novel alternative spliced Mpv17-like protein isoform localizes in cytosol and is expressed in a kidney- and adult-specific manner.
- Reiko Iida, et al.2003. J. Biol. Chem. M-LP, Mpv17-like protein, has a peroxisomal membrane targeting signal comprising a transmembrane domain and a positively charged loop and up-regulates expression of the manganese superoxide dismutase gene.
- R Iida, et al.2001. Biochem. Biophys. Res. Commun. Cloning, mapping, genomic organization, and expression of mouse M-LP, a new member of the peroxisomal membrane protein Mpv17 domain family.
- A Zwacka, et al.1994. EMBO J. The glomerulosclerosis gene Mpv17 encodes a peroxisomal protein producing reactive oxygen species.
- , et al.0. J. Am. Soc. Nephrol. Course of renal injury in the Mpv17-deficient transgenic mouse.
|