Gene : Pex7

Symbol :	Pex7
Name/description :	peroxisomal biogenesis factor 7
Synonyms :	MmPEX7
Organism :	Mus musculus
Peroxisomal Localization :	GO: protein targeting to peroxisome N Braverman, et al.1997. Nat. Genet. Pedro Brites, et al.2003. Hum. Mol. Genet. GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX7
Protein consensus sequence :	MSAARTLRVPGRHGYAAEFSPYLPGRLACAAAQHYGIAGCGTLLVLDQNESGLQIFRSFDWNDGLFDVTWSENNEHVLVTCSGDGSLQLWDTAKATGPLQVYKEHTQEVYSVDWSQTRGEQLVVSGSWDQTVKVWDPTVGNSLCTFRGHESVIYSTIWSPHIPGCFASASGDQTLRIWDVKTTGVRIVIPAHQTEILSCDWCKYNENLVVTGAVDCSLRGWDLRNVRQPVFELLGHTYAIRRVKFSPFHASVLASCSYDFTVRFWNFSKPDPLLETVEHHTEFTCGLDLSLQSPTQVADCSWDETIKIYDPVCLTVPG
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome targeting sequence binding
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help]
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Pedro Brites, et al.2009. Brain Plasmalogens participate in very-long-chain fatty acid-induced pathology. Pedro Brites, et al.2003. Hum. Mol. Genet. Impaired neuronal migration and endochondral ossification in Pex7 knockout mice: a model for rhizomelic chondrodysplasia punctata. Y Suzuki, et al.2001. J. Inherit. Metab. Dis. Clinical, biochemical and genetic aspects and neuronal migration in peroxisome biogenesis disorders. N Braverman, et al.2000. Genomics PEX7 gene structure, alternative transcripts, and evidence for a founder haplotype for the frequent RCDP allele, L292ter.