Gene : Scp2

Symbol :	Scp2
Name/description :	sterol carrier protein 2, liver
Synonyms :	SCPx, SCP-2, C76618, C79031, NSL-TP, ns-LTP, AA409774, AA409893
Organism :	Mus musculus
Peroxisomal Localization :	GO: peroxisome J Kolodner, et al.1994. Genomics GFP: No experiment found Mass Spectrometry: Jia Mi, et al.2007. PROTEOMICS Jia Mi, et al.2007. PROTEOMICS Sebastian Wiese, et al.2007. Mol. Cell PROTEOMICS PeroxisomeDB annotation
Protein family :	SCPX
Protein consensus sequence :	PTS1=0.017; start position=536; end position=547; MPSVALKSPRLRRVFVVGVGMTKFMKPGGENSRDYPDMAKEAGQKALEDAQIPYSAVEQACVGYVYGDSTSGQRAIYHSLGLTGIPIINVNNNCSTGSTALFMAHQLIQGGLANCVLALGFEKMERGSIGTKFSDRTTPTDKHIEVLIDKYGLSAHPITPQMFGYAGKEHMEKYGTKVEHFAKIGWKNHKHSVNNTYSQFQDEYSLEEVMKSKPVFDFLTILQCCPTSDGAAAAILSSEEFVQQYGLQSKAVEIVAQEMMTDLPSTFEEKSIIKVVGYDMSKEAARRCYEKSGLTPNDVDVIELHDCFSVNELITYEALGLCPEGQGGTLVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGLGGAVVVTLYRMGFPEAASSFRTHQVSAAPTSSAGDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKIAGNMGLAMKLQNLQLQPGKAKL
Functional category(ies) :	Branched chain fatty acid beta-oxidation Branched chain fatty acid oxidation Di- trihydroxycholestanoic acid beta-oxidation Di- trihydroxycholestanoic acid oxidation/Bile acid synthesis Fatty acid oxidation Fatty acid synthesis/PUFAS synthesis Long-chain dicarboxylic acids oxidation Straight chain fatty acids beta-oxidation Straight chain fatty acids oxidation Unsaturated fatty acid beta-oxidation
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help] Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	S Ferdinandusse, et al.2001. J. Lipid Res. Identification of the peroxisomal beta-oxidation enzymes involved in the biosynthesis of docosahexaenoic acid. A Knoll, et al.2000. Neurosci. Lett. Peroxisomal beta-oxidation enzyme gene expression in the developing mouse brain.