Gene : Pex11c

Symbol :	Pex11c
Name/description :	peroxisomal biogenesis factor 11 gamma
Synonyms :	Pex11gamma, 1810022F11Rik, 1810049N02Rik
Organism :	Mus musculus
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: Sebastian Wiese, et al.2007. Mol. Cell PROTEOMICS PeroxisomeDB annotation
Protein family :	PEX11
Protein consensus sequence :	MALLNRLASALESHRVRDRLIRTLGYCCQLIGGVLVEQCPNRSEVGRRLLVVSAQFNHCRTVLRLFDDLAMFVYTKQYGLGTKEEDIFIRWLSVLSNVTDQLYYPCEHIAWAADAKVLRVDSAWWWTLNTALWTLSLLLGAVK
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome division-proliferation
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help]
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Srikanth Karnati, et al.2009. Histochem. Cell Biol. Peroxisomes in airway epithelia and future prospects of these organelles for pulmonary cell biology. Xiaoling Li, et al.2002. Mol. Cell. Biol. PEX11 beta deficiency is lethal and impairs neuronal migration but does not abrogate peroxisome function.