Gene : ENSRNOG00000006539

Symbol :	ENSRNOG00000006539
Name/description :	Pex16
Synonyms :
Organism :	Rattus norvegicus
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX16
Protein consensus sequence :	MEKLRLLGLRYQEYVTRHPAATAQLETAVRGLSYLLAGRFSDSHELSELVYSASNLLVLLNDGILRKELRKKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALIQLAKAVLRMFLLIWFKTGIQTSPPIVPLDRETQAQPLDGDHNLGSPEPSYVGKRSNRVVRTLQNSPSLHSRHWGAPQQREIRQKQQQEELSTPPTPLGLQETIAESLYIARPLLHLLSLGLWGQRSWAPWLLSGVVDMTSLSLLSDRKNLTRRERLELRRRTILLLYYLLRSPFYDRFSEAKILFLLQLLADHIPGIGLVARPLMDYLPSWQKIYFYSWG
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome membrane assembly
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help]
Gene Info:	No banks found
Pubmed:	Takashi Matsuzaki, et al.2008. J. Cell Biol. The peroxisomal membrane protein import receptor Pex3p is directly transported to peroxisomes by a novel Pex19p- and Pex16p-dependent pathway. Clara Pinto, et al.2006. J. Biol. Chem. The import competence of a peroxisomal membrane protein is determined by Pex19p before the docking step.