Gene : Decr1

Symbol :	Decr1
Name/description :	2,4-dienoyl CoA reductase 1, mitochondrial
Synonyms :
Organism :	Rattus norvegicus
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PDCR
Protein consensus sequence :	MALLARAFFAGVSRLPCDPGPQRFFSFGTKTLYQSIDAPQSKFFPPILKPMLPPNAFQGKVAFITGGGTGLGKAMTTFLSSLGAQCVIASRNIDVLKATAEEITSKTGNKVYAIRCDVRDPDMVHNTVLELIKVAGHPDVVINNAAGNFISPSERLSPNGWKTITDIVLNGTAYVTLEIGKQLIKAQKGAAFLAITTIYAESGSGFVMPSSSAKSGVEAMNKSLAAEWGRYGMRFNIIQPGPIKTKGAFSRLDPTGKFEKDMIERIPCGRLGTVEELANLATFLCSDYASWINGAVIRFDGGEEVFLSGEFNSLKKVTKEEWDVIEGLIRKTKGS
Functional category(ies) :	Fatty acid synthesis/PUFAS synthesis Unsaturated fatty acid beta-oxidation
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help] Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	D Filppula, et al.1998. J. Biol. Chem. Delta3,5-delta2,4-dienoyl-CoA isomerase from rat liver. Molecular characterization. H Luthria, et al.1996. J. Biol. Chem. Regulation of the biosynthesis of 4,7,10,13,16,19-docosahexaenoic acid. H Luthria, et al.1995. J. Biol. Chem. Double bond removal from odd-numbered carbons during peroxisomal beta-oxidation of arachidonic acid requires both 2,4-dienoyl-CoA reductase and delta 3,5,delta 2,4-dienoyl-CoA isomerase. K Luo, et al.1994. J. Biol. Chem. Delta 3,5, delta 2,4-dienoyl-CoA isomerase from rat liver mitochondria. Purification and characterization of a new enzyme involved in the beta-oxidation of unsaturated fatty acids. H Osmundsen, et al.1991. Biochim. Biophys. Acta Metabolic aspects of peroxisomal beta-oxidation.