Gene : Acox1

Symbol :	Acox1
Name/description :	acyl-Coenzyme A oxidase 1, palmitoyl
Synonyms :	RATACOA1
Organism :	Rattus norvegicus
Peroxisomal Localization :	GO: peroxisome G Vanhove, et al.1992. J. Biol. Chem. GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	ACOX
Protein consensus sequence :	PTS1=0.0041; start position=608; end position=619; FCGTCWPQLLHVYSYLAESGHHCSAGEMAPVPRTPDNWHLRPDGDGPRSVHRGHPEPLDLHLGMFLPTLLHQATAEQQERFFMPAWNLEITGTYAQTEMGHGTHLRGLETTATYDPKTQEFILNSPTVTSIKWWPGGLGKTSNHAIVLAQLITQGECYGLHAFVVPIREIGTHKPLPGITVGDIGPKFGYEEMDNGYLKMDNYRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGNAAQSLSKACTIAIRYSAVRRQSEIKQSEPEPQILDFQTQQYKLFPLLATAYAFHFVGRYMKETYLRINESIGQGDLSELPELHALTAGLKAFTTWTANAGIEECRMACGGHGYSHSSGIPNIYVTFTPACTFEGENTVMMLQTARFLMKIYDQVRSGKLVGGMVSYLNDLPSQRIQPQQVAVWPTMVDINSLEGLTEAYKLRAARLVEIAAKNLQTHVSHRKSKEVAWNLTSVDLVRASEAHCHYVVVKVFSDKLPKIQDKAVQAVLRNLCLLYSLYGISQKGGDFLEGSIITGAQLSQVNARILELLTLIRPNAVALVDAFDFKDMTLGSVLGRYDGNVYENLFEWAKKSPLNKTEVHESYHKHLKPLQSKL
Functional category(ies) :	Branched chain fatty acid beta-oxidation Branched chain fatty acid oxidation Di- trihydroxycholestanoic acid beta-oxidation Di- trihydroxycholestanoic acid oxidation/Bile acid synthesis Fatty acid oxidation Fatty acid synthesis/PUFAS synthesis Long-chain dicarboxylic acids oxidation Straight chain fatty acids beta-oxidation Straight chain fatty acids oxidation Unsaturated fatty acid beta-oxidation
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help] Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Sizue Omi, et al.2008. J. Biochem. Contribution of peroxisome-specific isoform of Lon protease in sorting PTS1 proteins to peroxisomes. Paola Priore, et al.2007. Biochim. Biophys. Acta Metabolism and short-term metabolic effects of conjugated linoleic acids in rat hepatocytes. Jia Zeng, et al.2006. Biochim. Biophys. Acta Intrinsic enoyl-CoA isomerase activity of rat acyl-CoA oxidase I. M Depreter, et al.2002. J. Endocrinol. Modulation of the peroxisomal gene expression pattern by dehydroepiandrosterone and vitamin D: therapeutic implications. Yoshitaka Nakajima, et al.2002. J. Biochem. Three-dimensional structure of the flavoenzyme acyl-CoA oxidase-II from rat liver, the peroxisomal counterpart of mitochondrial acyl-CoA dehydrogenase.