| Symbol : |
Pex12 |
| Name/description : |
peroxisomal biogenesis factor 12 |
| Synonyms : |
|
| Organism : |
|
| Peroxisomal Localization : |
- GO: peroxisome
- GFP: No experiment found
- Mass Spectrometry:
- PeroxisomeDB annotation
|
| Protein family : |
|
| Protein consensus sequence : |
PEX19=0.078; start position=252; end position=261;
PEX19=0.093; start position=117; end position=126;
MAEHGAHITTASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPAHYGFFWRWFDEIFTLLDFLLQQHYLSRTSASFSEHFYGLKRIVAGSSPQLQRPASAGLPKEHLWKSAMFLVLLPYLKVKLEKLASTLREEDEYSIHPPSSHWKRFYRVFLAAYPFVTMTWEGWFLTQQLRYILGKAEHHSPLLKLAGVRLGRLTAQDIQAMEHRLVEASAMQEPVRSIGKKIKSALKKAVGGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKMKTVCPLCRKARVNDTVLATSGYVFCYRCVFNYVRSHQACPITGYPTEVQHLIKLYSPEN |
| Functional category(ies) : |
|
| Disease(s) : |
No diseases found
|
| Comparative genomics: |
|
| Gene Info: |
|
| Pubmed: |
- C Reguenga, et al.2001. J. Biol. Chem. Characterization of the mammalian peroxisomal import machinery: Pex2p, Pex5p, Pex12p, and Pex14p are subunits of the same protein assembly.
- K Ghaedi, et al.1999. Exp. Cell Res. Isolation and characterization of novel peroxisome biogenesis-defective Chinese hamster ovary cell mutants using green fluorescent protein.
- K Okumoto, et al.1998. Mol. Cell. Biol. PEX12, the pathogenic gene of group III Zellweger syndrome: cDNA cloning by functional complementation on a CHO cell mutant, patient analysis, and characterization of PEX12p.
- K Okumoto, et al.1997. Nat. Genet. PEX12 encodes an integral membrane protein of peroxisomes.
|