| Symbol : |
Uox |
| Name/description : |
urate oxidase |
| Synonyms : |
Uri, Uri2, UOX-2 |
| Organism : |
|
| Peroxisomal Localization : |
- GO: peroxisomal matrix
- GFP: No experiment found
- Mass Spectrometry:
- PeroxisomeDB annotation
|
| Protein family : |
|
| Protein consensus sequence : |
PTS1=0.0048; start position=292; end position=303;
MAHYHDDYGKNDEVEFVRTGYGKDMVKVLHIQRDGKYHSIKEVATSVQLTLRSKKDYLHGDNSDIIPTDTIKNTVHVLAKFKGIKSIETFAMNICEHFLSSFSHVTRAHVYVEEVPWKRFEKNGVKHVHAFIHTPTGTHFCDVEQVRNGPPIIHSGIKDLKVLKTTQSGFEGFIKDQFTTLPEVKDRCFATQVYCKWRYQNRDVDFEATWGAVRDIVLKKFAGPYDRGEYSPSVQKTLYDIQVLTLSQLPEIEDMEISLPNIHYFNIDMSKMGLINKEEVLLPLDNPYGKITGTVRRKLPSRL |
| Functional category(ies) : |
|
| Disease(s) : |
No diseases found
|
| Comparative genomics: |
|
| Gene Info: |
|
| Pubmed: |
- N Usuda, et al.1994. J. Cell. Sci. Uric acid degrading enzymes, urate oxidase and allantoinase, are associated with different subcellular organelles in frog liver and kidney.
- K Alvares, et al.1992. Proc. Natl. Acad. Sci. U.S.A. Rat urate oxidase produced by recombinant baculovirus expression: formation of peroxisome crystalloid core-like structures.
- D Hardeman, et al.1990. Biochim. Biophys. Acta Studies on peroxisomal membranes.
- A Aarsland, et al.1990. Biochim. Biophys. Acta The hypolipidemic peroxisome-proliferating drug, bis(carboxymethylthio)-1.10 decane, a dicarboxylic metabolite of tiadenol, is activated to an acylcoenzyme A thioester.
- K Motojima, et al.1988. J. Biol. Chem. Cloning and sequence analysis of cDNA for rat liver uricase.
|
