Gene : Gstk1

Symbol :	Gstk1
Name/description :	glutathione S-transferase kappa 1
Synonyms :	GST13-13, GSTkappa
Organism :	Rattus norvegicus
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: Miki Kikuchi, et al.2004. J. Biol. Chem. PeroxisomeDB annotation
Protein family :	GSTK1
Protein consensus sequence :	PTS1=0.0056; start position=215; end position=226; MGPAPRVLELFYDVLSPYSWLGFEVLCRYQHLWNIKLKLRPALLAGIMKDSGNQPPAMVPHKGQYILKEIPLLKQLFQVPMSVPKDFFGEHVKKGTVNAMRFLTAVSMEQPEMLEKVSRELWMRIWSRDEDITESQNILSAAEKAGMATAQAQHLLNKISTELVKSKLRETTGAACKYGAFGLPTTVAHVDGKTYMLFGSDRMELLAYLLGEKWMGPVPPTLNARL
Functional category(ies) :	Antioxidant Gluthatione peroxidase/Thioredoxin
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help] Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Markus Islinger, et al.2006. Proteomics Insights into the membrane proteome of rat liver peroxisomes: microsomal glutathione-S-transferase is shared by both subcellular compartments. K Tronstad, et al.2001. Biochem. Pharmacol. Growth reduction in glioma cells after treatment with tetradecylthioacetic acid: changes in fatty acid metabolism and oxidative status. M Depreter, et al.2000. J. Hepatol. Effects of extracellular matrix on the expression of peroxisomes in primary rat hepatocyte cultures. T Shoda, et al.1999. Arch. Toxicol. The relationship between decrease in Cx32 and induction of P450 isozymes in the early phase of clofibrate hepatocarcinogenesis in the rat. T Novikoff, et al.1991. Am. J. Pathol. Characterizations of and interactions between bile ductule cells and hepatocytes in early stages of rat hepatocarcinogenesis induced by ethionine.