Gene : LOC679129

Symbol :	LOC679129
Name/description :	similar to Peroxisomal biogenesis factor 19 (Peroxin-19) (Peroxisomal farnesylated protein)
Synonyms :	LOC679129
Organism :	Rattus norvegicus
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX19
Protein consensus sequence :	MAAAEGGCGAGVEADRELEELLESALDDFDKAKPSPAPSPTISAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLSGLAKNATDLQNAGMSEEELTKAMEGLGMDEGDGEGNILPIMQSLMQNLLSKDVLYPSLKEITEKYPEWLQSHQESIPPEQFEKYQQQHSVMGKICEQFEAETPTDSEATHRARFEAVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGANGEQCLIM
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome membrane assembly
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help]
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Takashi Matsuzaki, et al.2008. J. Cell Biol. The peroxisomal membrane protein import receptor Pex3p is directly transported to peroxisomes by a novel Pex19p- and Pex16p-dependent pathway. Yuji Matsuzono, et al.2006. J. Biol. Chem. In vitro transport of membrane proteins to peroxisomes by shuttling receptor Pex19p. Clara Pinto, et al.2006. J. Biol. Chem. The import competence of a peroxisomal membrane protein is determined by Pex19p before the docking step. Ute Brosius, et al.2002. J. Biol. Chem. Two different targeting signals direct human peroxisomal membrane protein 22 to peroxisomes. X Sacksteder, et al.2000. J. Cell Biol. PEX19 binds multiple peroxisomal membrane proteins, is predominantly cytoplasmic, and is required for peroxisome membrane synthesis.