Gene : Fndc5

Symbol :	Fndc5
Name/description :	fibronectin type III domain containing 5
Synonyms :
Organism :	Rattus norvegicus
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	FNDC5
Protein consensus sequence :	MPPGPCAWPPRAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDEVDRLASSEDKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPRKEPGTSLSLPADEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKGSDSIKHFPDPDIEGICGMRSPLQMWMIPVI
Functional category(ies) :	Classification Unknown
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help]
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) ENSEMBL Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Armando Soto, et al.2008. Toxicology D-Serine exposure resulted in gene expression changes indicative of activation of fibrogenic pathways and down-regulation of energy metabolism and oxidative stress response. T Kang, et al.1988. J. Histochem. Cytochem. Cytochemical changes in hepatocytes of rats with endotoxemia or sepsis: localization of fibronectin, calcium, and enzymes.