Gene : RGD1564999

Symbol :	RGD1564999
Name/description :	similar to isopentenyl-diphosphate delta isomerase 2
Synonyms :
Organism :	Rattus norvegicus
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	IDI
Protein consensus sequence :	VCSNRQAFILKYVTNSITYMSDVTVDWIDKHQLQRLDEMLIIVDENDKVIGADTKRNCHQNKNIEKGLLHRAFSVALFNSEKKVLIQRRADTKLTFPGYFSDSCSSHPLSNPEEMEEKDALGVKRAALRRLQAELGIAQDQVSLEDIVFMTRYHYKAKSDAVWGEHEVCYLLLIKKDVKICADPSEVSSFSYLTREELEELLERGARGEVQVTPWLRFVVEQFLYAWWPYLDEATKFIELDKIYRV
Functional category(ies) :	Isoprenoid metabolism Metabolism
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help]
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) ENSEMBL Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Paton Paton, et al.1997. J. Biol. Chem. Cloning and subcellular localization of hamster and rat isopentenyl diphosphate dimethylallyl diphosphate isomerase. A PTS1 motif targets the enzyme to peroxisomes.