Gene : RGD1562373

Symbol :	RGD1562373
Name/description :	similar to 3-ketoacyl-CoA thiolase B, peroxisomal precursor (Beta-ketothiolase B)
Synonyms :
Organism :	Rattus norvegicus
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	ACAA1
Protein consensus sequence :	PTS2=1.6e-008; start position=3; end position=11; MHRLQVVLGHLAGRSESSSALQAAPCSAGFPQASASDVVVVHGRRTPIGRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLQPGAGAAMARIAQFLSGIPETVPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTLSERGNPGNISSRLLENEKARDCLIPMGITSENVAERFGISRQKQDAFALASQQKAASAQSKGCFRAEIVPVTTTVLDDKGDRKTITVSQDEGVRPSTTMEGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRAYGVVSMCIGTGMGAAAVFEYP
Functional category(ies) :	Fatty acid oxidation Fatty acid synthesis/PUFAS synthesis Long-chain dicarboxylic acids oxidation Straight chain fatty acids beta-oxidation Straight chain fatty acids oxidation Unsaturated fatty acid beta-oxidation
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help] Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	N Kinoshita, et al.1998. J. Biol. Chem. Newly identified Chinese hamster ovary cell mutants are defective in biogenesis of peroxisomal membrane vesicles (Peroxisomal ghosts), representing a novel complementation group in mammals. U Seedorf, et al.1994. J. Biol. Chem. Sterol carrier protein X is peroxisomal 3-oxoacyl coenzyme A thiolase with intrinsic sterol carrier and lipid transfer activity. S Miura, et al.1994. J. Biochem. Post-translational import of 3-ketoacyl-CoA thiolase into rat liver peroxisomes in vitro. S Swinkels, et al.1991. EMBO J. A novel, cleavable peroxisomal targeting signal at the amino-terminus of the rat 3-ketoacyl-CoA thiolase. S Miura, et al.1984. J. Biol. Chem. Biosynthesis and intracellular transport of enzymes of peroxisomal beta-oxidation.