| Symbol : |
Idi2l |
| Name/description : |
isopentenyl-diphosphate delta isomerase 2-like |
| Synonyms : |
Idi2 |
| Organism : |
|
| Peroxisomal Localization : |
- GO: No Peroxisomal annotation
- GFP: No experiment found
- Mass Spectrometry: No experiment found
- PeroxisomeDB annotation
|
| Protein family : |
|
| Protein consensus sequence : |
VCSNRQAFILKYVTNSITYMSDVTVDWIDKHQLQRLDEMLIVVDENDKVIGADTKRNCHQNKNIEKGLLHRAFSVVLFNSEKKVLIQRRADTKLTFPGYYTDSCYSHPLSNPEEMEEKDALGVKRAALRRLQAELGIPQDQVSLEDIVFMKRYHYKAKSDAVWGEHEVCYLLLIKKDVKICPDPSEVSSFSYLTREELEELLERGARGEVQVTPWLRFVVEQFLYAWWPYLDEATRFIELDKIYRV |
| Functional category(ies) : |
|
| Disease(s) : |
No diseases found
|
| Comparative genomics: |
|
| Gene Info: |
|
| Pubmed: |
- Paton Paton, et al.1997. J. Biol. Chem. Cloning and subcellular localization of hamster and rat isopentenyl diphosphate dimethylallyl diphosphate isomerase. A PTS1 motif targets the enzyme to peroxisomes.
|
