Gene : prx-19

Symbol :	prx-19
Name/description :	PeRoXisome assembly factor family member (prx-19)
Synonyms :
Organism :	Caenorhabditis elegans
Peroxisomal Localization :	GO: peroxisome Evelyn Camon, et al.2003. Genome Res. GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX19
Protein consensus sequence :	MTDETTQNIKDKTEEELAALLDQTLGEFTATPAPKPRTTDDELDELMASADQEAAQKAAKDFQKMLEQMVTLQEEAMKKAGADPSEGEGEQPLDPNDPEALAMMDALKQLMECSSNVANASNPEEFMAGLDMLRSPNSPMEPFMSMIMQTLASKEVMYPPLKEIFDNYPKYLEDNGAGLDAETKERYEKQFEVLGKICTEFEKQPELAEVQPVDAATQPAPEADPASIEHFEKLGKLLVELQQYGYPPKELVGALPDGWQIDESGLPKVADAAAATEACSIM
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome membrane assembly
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help]
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	A Snyder, et al.1999. Mol. Biol. Cell Pex19p interacts with Pex3p and Pex10p and is essential for peroxisome biogenesis in Pichia pastoris.