Gene : O65634

Symbol :	O65634
Name/description :	O65634
Synonyms :
Organism :	Arabidopsis thaliana
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	APX
Protein consensus sequence :	MAVNVDAEYLKEIEKTRRDLRALISSRNCAPIMLRLAWHDAGTYDAKKKTGGANGSIRFKEELNRPHNKGLEKAVAFCEEVKAKHPRVSYADLYQLAGVVAVEVTGGPAIPFTPGRKDADSADDGELPNPNEGASHLRTLFSRMGLLDRDIVALSGGHTLGRAHKERSDFEGPWTQDPLKFDNSYFVELLKGETPGLLQLKTDKALLDDPKFHPFVKLYAKDEDMFFKAYAISHKKLSELGFNPPRRIPSAVTQQTLGIAVAAAVVIFTICYEASRRGK
Functional category(ies) :	Antioxidant Metabolism
Disease(s) :	No diseases found
Comparative genomics:	Alignment
Gene Info:	No banks found
Pubmed:	Eastmond Eastmond, et al.2007. Plant Cell MONODEHYROASCORBATE REDUCTASE4 is required for seed storage oil hydrolysis and postgerminative growth in Arabidopsis. Petra Zimmermann, et al.2006. Plant Cell Environ. Senescence-specific regulation of catalases in Arabidopsis thaliana (L.) Heynh. Lisenbee Lisenbee, et al.2005. Plant J. Arabidopsis peroxisomes possess functionally redundant membrane and matrix isoforms of monodehydroascorbate reductase. Irene Murgia, et al.2004. Plant J. Arabidopsis thaliana plants overexpressing thylakoidal ascorbate peroxidase show increased resistance to Paraquat-induced photooxidative stress and to nitric oxide-induced cell death. Mullen Mullen, et al.2001. Trends Plant Sci. How are peroxisomes formed? The role of the endoplasmic reticulum and peroxins.