| Symbol : |
OPR3_ARATH |
| Name/description : |
OPR3_ARATH |
| Synonyms : |
|
| Organism : |
|
| Peroxisomal Localization : |
- GO: No Peroxisomal annotation
- GFP: No experiment found
- Mass Spectrometry: No experiment found
- PeroxisomeDB annotation
|
| Protein family : |
|
| Protein consensus sequence : |
MTAAQGNSNETLFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEYYAQRTTPGGFLISEGTMVSPGSAGFPHVPGIYSDEQVEAWKQVVEAVHAKGGFIFCQLWHVGRASHAVYQPNGGSPISSTNKPISENRWRVLLPDGSHVKYPKPRALEASEIPRVVEDYCLSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQYGGSIANRCRFLKQVVEGVVSAIGASKVGVRVSPAIDHLDATDSDPLSLGLAVVGMLNKLQGVNGSKLAYLHVTQPRYHAYGQTESGRQGSDEEEAKLMKSLRMAYNGTFMSSGGFNKELGMQAVQQGDADLVSYGRLFIANPDLVSRFKIDGELNKYNRKTFYTQDPVVGYTDYPFLAPFSRL |
| Functional category(ies) : |
|
| Disease(s) : |
No diseases found
|
| Comparative genomics: |
|
| Gene Info: |
No banks found
|
| Pubmed: |
- Tomoyuki Tani, et al.2008. Planta Identification of the OsOPR7 gene encoding 12-oxophytodienoate reductase involved in the biosynthesis of jasmonic acid in rice.
- Jochen Strassner, et al.2002. Plant J. Characterization and cDNA-microarray expression analysis of 12-oxophytodienoate reductases reveals differential roles for octadecanoid biosynthesis in the local versus the systemic wound response.
|
