Gene : SPAC17C9.14

Symbol :	SPAC17C9.14
Name/description :	Pex19 protein family
Synonyms :
Organism :	Schizosaccharomyces pombe
Peroxisomal Localization :	GO: protein targeting to peroxisome Martin Aslett, et al.2006. Yeast GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX19
Protein consensus sequence :	MSNPTIEGDENRKENTKSNTKPNFDDLDDLDDILDDLDVPSAFKNEEKKNIDEHKQTGNTSKENERIKNDDNLNSLIQEMMSKFEDLGGPSGLDGSQLSSSFQNDQLLNVILEDQFATEKDSDNGAVNYGALEAALNSLMSQVTSKEILYEPLKDLEANYPKFLKNAKETEKQGFEEQYQKIQKCIQIFESPEYDARKDADIISKLVEEIQEKPLPAPLIDNSMETAGCPTQ
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome membrane assembly
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help]
Gene Info:	No banks found
Pubmed:	A Snyder, et al.1999. Mol. Biol. Cell Pex19p interacts with Pex3p and Pex10p and is essential for peroxisome biogenesis in Pichia pastoris.