Gene : AFUA_2G11350

Symbol : AFUA_2G11350
Name/description : No Symbol found
Synonyms :
Organism :
Peroxisomal Localization :
  • GO: No Peroxisomal annotation
  • GFP: No experiment found
  • Mass Spectrometry: No experiment found
  • PeroxisomeDB annotation
Protein family :
Protein consensus sequence : MSTPQQRLSSIANQVAGSNVSAKSKLLAKNPDDIVITLAVRTPLTKARKGGLKDTTVDNLLISLLTSIREKSNLDPNLVEDVCVGNVLAPGSAYIARSAVLAAGFPVTAAASIANRFCSSGLLAIQNVANQIMAGSIDIGIAVGAESMSTNADGGAPEMSAQILSHPIASQNTQPMGQTSENVAAQFNISREQHDQFAAKSYQKAERAQKSGWTADEIVPVKTQVKDPKTGEVKDVVVDRDDGIRYGTTVESLSKIRSAFPQWKPSATTGGNASQITDGAAGVILMKRSRAQELGQPIIGKFCGATVAGLEPRIMGIGPSIAIPKILSKFNLSKDDIDIFEINEAFASMGVYCVNKLGLDESKVNPRGGAIALGHPLGCTGARQVVTALSELRRQNKRIAVTSMCVGTGMGMAGIFVSEH
Functional category(ies) :
Disease(s) : No diseases found
Comparative genomics:
Gene Info:
Pubmed:
  • Lee Lee, et al.2009. BMB Rep Antifungal activity of Saccharomyces cerevisiae peroxisomal 3-ketoacyl-CoA thiolase.
  • E Record, et al.2001. Gene Cloning and expression in phospholipid containing cultures of the gene encoding the specific phosphatidylglycerol/phosphatidylinositol transfer protein from Aspergillus oryzae: evidence that the pg/pi-tp is tandemly arranged with the putative 3-ketoacyl-CoA thiolase gene.
  • S Valenciano, et al.1998. Arch. Microbiol. Characterization of Aspergillus nidulans peroxisomes by immunoelectron microscopy.