| Symbol : |
AFUA_2G11350 |
| Name/description : |
No Symbol found |
| Synonyms : |
|
| Organism : |
|
| Peroxisomal Localization : |
- GO: No Peroxisomal annotation
- GFP: No experiment found
- Mass Spectrometry: No experiment found
- PeroxisomeDB annotation
|
| Protein family : |
|
| Protein consensus sequence : |
MSTPQQRLSSIANQVAGSNVSAKSKLLAKNPDDIVITLAVRTPLTKARKGGLKDTTVDNLLISLLTSIREKSNLDPNLVEDVCVGNVLAPGSAYIARSAVLAAGFPVTAAASIANRFCSSGLLAIQNVANQIMAGSIDIGIAVGAESMSTNADGGAPEMSAQILSHPIASQNTQPMGQTSENVAAQFNISREQHDQFAAKSYQKAERAQKSGWTADEIVPVKTQVKDPKTGEVKDVVVDRDDGIRYGTTVESLSKIRSAFPQWKPSATTGGNASQITDGAAGVILMKRSRAQELGQPIIGKFCGATVAGLEPRIMGIGPSIAIPKILSKFNLSKDDIDIFEINEAFASMGVYCVNKLGLDESKVNPRGGAIALGHPLGCTGARQVVTALSELRRQNKRIAVTSMCVGTGMGMAGIFVSEH |
| Functional category(ies) : |
|
| Disease(s) : |
No diseases found
|
| Comparative genomics: |
|
| Gene Info: |
|
| Pubmed: |
- Lee Lee, et al.2009. BMB Rep Antifungal activity of Saccharomyces cerevisiae peroxisomal 3-ketoacyl-CoA thiolase.
- E Record, et al.2001. Gene Cloning and expression in phospholipid containing cultures of the gene encoding the specific phosphatidylglycerol/phosphatidylinositol transfer protein from Aspergillus oryzae: evidence that the pg/pi-tp is tandemly arranged with the putative 3-ketoacyl-CoA thiolase gene.
- S Valenciano, et al.1998. Arch. Microbiol. Characterization of Aspergillus nidulans peroxisomes by immunoelectron microscopy.
|