Gene : PEX22

Symbol :	PEX22
Name/description :	Pex22p Putative peroxisomal membrane protein required for import of peroxisomal proteins, functionally complements a Pichia pastoris pex22 mutation
Synonyms :	YAF5
Organism :	Saccharomyces cerevisiae
Peroxisomal Localization :	GO: integral to peroxisomal membrane A Koller, et al.1999. J. Cell Biol. Fouzi Platta, et al.2007. J. Cell Biol. GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX22
Protein consensus sequence :	MPPPSRSRINKTRTLGIVGTAIAVLVTSYYIYQKVTSAKEDNGARPPEGDSVKENKKARKSKCIIMSKSIQGLPIKWEEYAADEVVLLVPTSHTDGSMKQAIGDAFRKTKNEHKIIYCDSMDGLWSCVRRLGKFQCILNSRDFTSSGGSDAAVVPEDIGRFVKFVVDSDVEDVLIDTLCN
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome matrix protein import
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	André Halbach, et al.2009. J. Biol. Chem. The N-domain of Pex22p can functionally replace the Pex3p N-domain in targeting and peroxisome formation. Astrid Kragt, et al.2005. J. Biol. Chem. The Saccharomyces cerevisiae peroxisomal import receptor Pex5p is monoubiquitinated in wild type cells. A Koller, et al.1999. J. Cell Biol. Pex22p of Pichia pastoris, essential for peroxisomal matrix protein import, anchors the ubiquitin-conjugating enzyme, Pex4p, on the peroxisomal membrane.