Gene : PEX32

Symbol :	PEX32
Name/description :	Peroxisomal integral membrane protein, involved in negative regulation of peroxisome size; partially functionally redundant with Pex31p; genetic interactions suggest action at a step downstream of steps mediated by Pex28p and Pex29p
Synonyms :
Organism :	Saccharomyces cerevisiae
Peroxisomal Localization :	GO: integral to peroxisomal membrane David Vizeacoumar, et al.2004. Mol. Biol. Cell GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX23
Protein consensus sequence :	MDTNSKTKVQTENKKIKAKFIHNHGQKPSLIQITPPMISSTLFHAYPLLLIFDNALANIMWLSDDKCLTFIYLTSIWLTISFFIPVETEASHFLPFTKILRLWLGIISGAFLFLSFMYYIVSLIASLRDTEPPTLDEIVVLLESVLDKLEVLRNELNVWKKLKLSFDGVNKECSGKRLFCRLFLFGTIFQIIIMRYISPGTYTRFFIITGLIYNTSSFQATLRLLWRFTAVRNFYYLGIESFKISSFLPKHLKMEQIIPLSQGRAITVPLVEVLPKLLRDKKGDDHIHILQLLLNEQKDNFGNEDLKILEIEVYENQRRWYQNKNWSTKLLPYERQNYCIEIKNTDGTLTMRSCLPPDGLGEEELPNNWHWINDNWDGTDWIYSDSAWKEIGQYSSLESFTRSRKWKRRLFHL
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome division-proliferation
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	David Vizeacoumar, et al.2004. Mol. Biol. Cell Pex30p, Pex31p, and Pex32p form a family of peroxisomal integral membrane proteins regulating peroxisome size and number in Saccharomyces cerevisiae. Brown Brown, et al.2000. Mol. Biol. Cell Mutants of the Yarrowia lipolytica PEX23 gene encoding an integral peroxisomal membrane peroxin mislocalize matrix proteins and accumulate vesicles containing peroxisomal matrix and membrane proteins.