Gene : PCS60

Symbol :	PCS60
Name/description :	Pcs60p Peroxisomal AMP-binding protein, localizes to both the peroxisomal peripheral membrane and matrix, expression is highly inducible by oleic acid, similar to E. coli long chain acyl-CoA synthetase
Synonyms :	FAT2
Organism :	Saccharomyces cerevisiae
Peroxisomal Localization :	GO: peroxisomal membrane F Blobel, et al.1996. Eur. J. Biochem. GFP: No experiment found Mass Spectrometry: Marcello Yi, et al.2002. Electrophoresis PeroxisomeDB annotation
Protein family :	FACL
Protein consensus sequence :	PTS1=0.00063; start position=532; end position=543; MTSAATVTASFNDTFSVSDNVAVIVPETDTQVTYRDLSHMVGHFQTMFTNPNSPLYGAVFRQDTVAISMRNGLEFIVAFLGATMDAKIGAPLNPNYKEKEFNFYLNDLKSKAICVPKGTTKLQSSEILKSASTFGCFIVELAFDATRFRVEYDIYSPEDNYKRVIYRSLNNAKFVNTNPVKFPGFARSSDVALILHTSGTTSTPKTVPLLHLNIVRSTLNIANTYKLTPLDRSYVVMPLFHVHGLIGVLLSTFRTQGSVVVPDGFHPKLFWDQFVKYNCNWFSCVPTISMIMLNMPKPNPFPHIRFIRSCSSALAPATFHKLEKEFNAPVLEAYAMTEASHQMTSNNLPPGKRKPGTVGQPQGVTVVILDDNDNVLPPGKVGEVSIRGENVTLGYANNPKANKENFTKRENYFRTGDQGYFDPEGFLVLTGRIKELINRGGEKISPIELDGIMLSHPKIDEAVAFGVPDDMYGQVVQAAIVLKKGEKMTYEELVNFLKKHLASFKIPTKVYFVDKLPKTATGKIQRRVIAETFAKSSRNKSKL
Functional category(ies) :	Lipid metabolism Long/very long fatty acids activation
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Jyh-Feng Heinzer, et al.2003. Hum. Mol. Genet. A very long-chain acyl-CoA synthetase-deficient mouse and its relevance to X-linked adrenoleukodystrophy. Martin Fulda, et al.2002. Plant J. Two long-chain acyl-CoA synthetases from Arabidopsis thaliana involved in peroxisomal fatty acid beta-oxidation. Stephan Heinzer, et al.2002. J. Biol. Chem. Mouse very long-chain acyl-CoA synthetase in X-linked adrenoleukodystrophy. Watkins Watkins, et al.1998. J. Biol. Chem. Disruption of the Saccharomyces cerevisiae FAT1 gene decreases very long-chain fatty acyl-CoA synthetase activity and elevates intracellular very long-chain fatty acid concentrations. A Uchiyama, et al.1996. J. Biol. Chem. Molecular cloning of cDNA encoding rat very long-chain acyl-CoA synthetase.