Gene : PEX19

Symbol :	PEX19
Name/description :	Chaperone and import receptor for newly-synthesized class I peroxisomal membrane proteins (PMPs), binds PMPs in the cytoplasm and delivers them to the peroxisome for subsequent insertion into the peroxisomal membrane
Synonyms :	PAS12
Organism :	Saccharomyces cerevisiae
Peroxisomal Localization :	GO: peroxisomal membrane K Götte, et al.1998. Mol. Cell. Biol. W Hettema, et al.2000. EMBO J. Wolfgang Girzalsky, et al.2006. J. Biol. Chem. GFP: Klaus Natter, et al.2005. Mol. Cell PROTEOMICS Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX19
Protein consensus sequence :	MPNIQHEVMNENEYDNFDDLDDLLDEDPTKLDEAEPDDVQAKGSVYNDSENKEKNAESKDSDGVQVANESEEDPELKEMMVDLQNEFANLMKNNGNENNVKTEDFNKLISALEEAAKVPHQQMEQGCSSLKSNSTDKGTVNGSNPGFKNIVSNTLDRLKENGNKVDTSLAEETKESQRSGQNNNIDDILSQLLDQMVASGGKESAENQFDLKDGEMDDAITKILDQMTSKEVLYEPMKEMRSEFGVWFQENGENEEHKEKIGTYKRQFNIVDEIVNIYELKDYDELKHKDRVTELLDELEQLGDSPIRSANSPLKHGNEEEELMKMLEIDGNDPNLGNLDKELTDGCKQQ
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome membrane assembly
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Yukio Fujiki, et al.2006. Biochim. Biophys. Acta Import of peroxisomal membrane proteins: the interplay of Pex3p- and Pex19p-mediated interactions. AndrÃ© Halbach, et al.2006. J. Cell. Sci. Targeting of the tail-anchored peroxisomal membrane proteins PEX26 and PEX15 occurs through C-terminal PEX19-binding sites. Wolfgang Girzalsky, et al.2006. J. Biol. Chem. Pex19p-dependent targeting of Pex17p, a peripheral component of the peroxisomal protein import machinery. Vizeacoumar Vizeacoumar, et al.2006. J. Biol. Chem. Pex19p binds Pex30p and Pex32p at regions required for their peroxisomal localization but separate from their peroxisomal targeting signals. Monica Vizeacoumar, et al.2006. J. Biol. Chem. The dynamin-like protein Vps1p of the yeast Saccharomyces cerevisiae associates with peroxisomes in a Pex19p-dependent manner.