Gene : PEX14

Symbol :	PEX14
Name/description :	Peroxisomal membrane peroxin that is a central component of the peroxisomal protein import machinery; interacts with both PTS1 (Pex5p) and PTS2 (Pex7p), peroxisomal matrix protein signal recognition factors and membrane receptor Pex13p
Synonyms :
Organism :	Saccharomyces cerevisiae
Peroxisomal Localization :	GO: peroxisomal membrane C Brocard, et al.1997. EMBO J. Karsten Niederhoff, et al.2005. J. Biol. Chem. GFP: Klaus Natter, et al.2005. Mol. Cell PROTEOMICS Won-Ki Huh, et al.2003. Nature Marcello Yi, et al.2002. Electrophoresis Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX14
Protein consensus sequence :	MSDVVSKDRKALFDSAVSFLKDESIKDAPLLKKIEFLKSKGLTEKEIEIAMKEPKKDGIVGDEVSKKIGSTENRASQDMYLYEAMPPTLPHRDWKDYFVMATATAGLLYGAYEVTRRYVIPNILPEAKSKLEGDKKEIDDQFSKIDTVLNAIEAEQAEFRKKESETLKELSDTIAELKQALVQTTRSREKIEDEFRIVKLEVVNMQNTIDKFVSDNDGMQELNNIQKEMESLKSLMNNRMESGNAQDNRLFSISPNGIPGIDTIPSASEILAKMGMQEESDKEKENGSDANKDDNAVPAWKKAREQTIDSNASIPEWQKNTAANEISVPDWQNGQVEDSIP
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome docking
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Wolfgang Azevedo, et al.2006. Biochim. Biophys. Acta Pex14p, more than just a docking protein. Daniela Kerssen, et al.2006. J. Biol. Chem. Membrane association of the cycling peroxisome import receptor Pex5p. Wolfgang Girzalsky, et al.2006. J. Biol. Chem. Pex19p-dependent targeting of Pex17p, a peripheral component of the peroxisomal protein import machinery. Karsten Niederhoff, et al.2005. J. Biol. Chem. Yeast Pex14p possesses two functionally distinct Pex5p and one Pex7p binding sites. Andrei Tam, et al.2005. J. Biol. Chem. Pex3p initiates the formation of a preperoxisomal compartment from a subdomain of the endoplasmic reticulum in Saccharomyces cerevisiae.