Symbol : |
PEX31 |
Name/description : |
Peroxisomal integral membrane protein, involved in negative regulation of peroxisome size; partially functionally redundant with Pex30p and Pex32p; probably acts at a step downstream of steps mediated by Pex28p and Pex29p
|
Synonyms : |
|
Organism : |
|
Peroxisomal Localization : |
- GO: integral to peroxisomal membrane
- GFP: No experiment found
- Mass Spectrometry: No experiment found
- PeroxisomeDB annotation
|
Protein family : |
|
Protein consensus sequence : |
MSEINNENLEPTSSTVAESTESKNKHIRSALRKRRGKLSAQTYEEDQEAILSSPLLTSTPKTVSRSLVRLYPYLIVVDNFLSIITWSNDNVSANLLGIFLFTVCVLYFGFITRYFGHLMIVGIIWVYLLIDKHVQETMASCPSLDDIIHVMDRVSMKSSAVLSPITILSAQDVRRLLFTIAFLSPVYIFLTVFVLSPNYLMLIGGLYVLTYHSKLIRRMRRYLWKFRVVRLLVFFITGLDLGGPDNNRRLFASVNKKIRSFVWNEVGNTSNTKKTVLFKVALFENQRRWLGIGWTSTMLSYERASWTDEFLNTSPSPEVFTLPEEQSGMAWEWHDKDWMLDLTNDGIIQLPASAAKTKVKPGADEGFIYYDNTWNNPSATDTYKKYTRRRRWIRTATVTTTYDDEPTVEKATPNSHALKSEENNRVRKRKVSFSTANEVHIIPSSDSSKLIQISDVSMSPSL |
Functional category(ies) : |
|
Disease(s) : |
No diseases found
|
Comparative genomics: |
|
Gene Info: |
|
Pubmed: |
- David Vizeacoumar, et al.2004. Mol. Biol. Cell Pex30p, Pex31p, and Pex32p form a family of peroxisomal integral membrane proteins regulating peroxisome size and number in Saccharomyces cerevisiae.
- Brown Brown, et al.2000. Mol. Biol. Cell Mutants of the Yarrowia lipolytica PEX23 gene encoding an integral peroxisomal membrane peroxin mislocalize matrix proteins and accumulate vesicles containing peroxisomal matrix and membrane proteins.
|