Gene : PEX4

Symbol :	PEX4
Name/description :	Peroxisomal ubiquitin conjugating enzyme required for peroxisomal matrix protein import and peroxisome biogenesis Pex4p
Synonyms :	UBC10, PAS2
Organism :	Saccharomyces cerevisiae
Peroxisomal Localization :	GO: peroxisome Wiebel Wiebel, et al.1992. Nature R Erdmann, et al.1989. Proc. Natl. Acad. Sci. U.S.A. Fouzi Platta, et al.2007. J. Cell Biol. GFP: Klaus Natter, et al.2005. Mol. Cell PROTEOMICS Won-Ki Huh, et al.2003. Nature Marcello Yi, et al.2002. Electrophoresis Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX4
Protein consensus sequence :	MPNFWILENRRSYTSDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERINNH
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome matrix protein import
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Chris Williams, et al.2007. J. Biol. Chem. A conserved cysteine is essential for Pex4p-dependent ubiquitination of the peroxisomal import receptor Pex5p. Fouzi Platta, et al.2007. J. Cell Biol. Ubiquitination of the peroxisomal import receptor Pex5p is required for its recycling. Astrid Kragt, et al.2005. J. Biol. Chem. The Saccharomyces cerevisiae peroxisomal import receptor Pex5p is monoubiquitinated in wild type cells. Wolfgang Platta, et al.2004. Biochem. J. Ubiquitination of the peroxisomal import receptor Pex5p. Nils Eckert, et al.2003. J. Cell. Sci. Pex10p links the ubiquitin conjugating enzyme Pex4p to the protein import machinery of the peroxisome.