Gene : FIS1

Symbol :	FIS1
Name/description :	Fis1p Mitochondrial outer membrane protein involved in membrane fission, required for localization of Dnm1p and Mdv1p during mitochondrial division; mediates ethanol-induced apoptosis and ethanol-induced mitochon
Synonyms :	MDV2
Organism :	Saccharomyces cerevisiae
Peroxisomal Localization :	GO: peroxisome Kasinath Kuravi, et al.2006. J. Cell. Sci. GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	FIS1
Protein consensus sequence :	MTKVDFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQKETLKGVVVAGGVLAGAVAVASFFLRNKRR
Functional category(ies) :	Peroxisome organization
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Salvador Picton, et al.2009. Biochemistry Evidence for conformational heterogeneity of fission protein Fis1 from Saccharomyces cerevisiae. Shirisha Nagotu, et al.2008. Traffic Peroxisome fission in Hansenula polymorpha requires Mdv1 and Fis1, two proteins also involved in mitochondrial fission. Kasinath Kuravi, et al.2006. J. Cell. Sci. Dynamin-related proteins Vps1p and Dnm1p control peroxisome abundance in Saccharomyces cerevisiae.