Symbol : |
TES1 |
Name/description : |
Peroxisomal acyl-CoA thioesterase likely to be involved in fatty acid oxidation rather than fatty acid synthesis; conserved protein also found in human peroxisomes; TES1 mRNA levels increase during growth on fatty acids
|
Synonyms : |
PTE1 |
Organism : |
|
Peroxisomal Localization : |
- GO: peroxisome
- GFP: No experiment found
- Mass Spectrometry:
- PeroxisomeDB annotation
|
Protein family : |
|
Protein consensus sequence : |
PTS1=0.036; start position=338; end position=349;
MSASKMAMSNLEKILELVPLSPTSFVTKYLPAAPVGSKGTFGGTLVSQSLLASLHTVPLNFFPTSLHSYFIKGGDPRTKITYHVQNLRNGRNFIHKQVSAYQHDKLIFTSMILFAVQRSKEHDSLQHWETIPGLQGKQPDPHRYEEATSLFQKEVLDPQKLSRYASLSDRFQDATSMSKYVDAFQYGVMEYQFPKDMFYSARHTDELDYFVKVRPPITTVEHAGDESSLHKHHPYRIPKSITPENDARYNYVAFAYLSDSYLLLTIPYFHNLPLYCHSFSVSLDHTIYFHQLPHVNNWIYLKISNPRSHWDKHLVQGKYFDTQSGRIMASVSQEGYVVYGSERDIRAKF |
Functional category(ies) : |
|
Disease(s) : |
No diseases found
|
Comparative genomics: |
|
Gene Info: |
|
Pubmed: |
No references found
|