| Symbol : |
AHP1 |
| Name/description : |
Ahp1p
Thiol-specific peroxiredoxin, reduces hydroperoxides to protect against oxidative damage; function in vivo requires covalent conjugation to Urm1p |
| Synonyms : |
|
| Organism : |
|
| Peroxisomal Localization : |
- GO: No Peroxisomal annotation
- GFP: No experiment found
- Mass Spectrometry: No experiment found
- PeroxisomeDB annotation
|
| Protein family : |
|
| Protein consensus sequence : |
PTS1=0.047; start position=165; end position=176;
MSDLVNKKFPAGDYKFQYIAISQSDADSESCKMPQTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL |
| Functional category(ies) : |
|
| Disease(s) : |
No diseases found
|
| Comparative genomics: |
|
| Gene Info: |
|
| Pubmed: |
No references found
|