Gene : AHP1

Symbol : AHP1
Name/description : Ahp1p Thiol-specific peroxiredoxin, reduces hydroperoxides to protect against oxidative damage; function in vivo requires covalent conjugation to Urm1p
Synonyms :
Organism :
Peroxisomal Localization :
  • GO: No Peroxisomal annotation
  • GFP: No experiment found
  • Mass Spectrometry: No experiment found
  • PeroxisomeDB annotation
Protein family :
Protein consensus sequence : 
PTS1=0.047; start position=165; end position=176;
MSDLVNKKFPAGDYKFQYIAISQSDADSESCKMPQTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL
Functional category(ies) :
Disease(s) : No diseases found
Comparative genomics:
Gene Info:
Pubmed: No references found