Gene : SYM1

Symbol :	SYM1
Name/description :	Protein required for ethanol metabolism; induced by heat shock and localized to the inner mitochondrial membrane; homologous to mammalian peroxisomal membrane protein Mpv17 Sym1p
Synonyms :
Organism :	Saccharomyces cerevisiae
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	MPV17
Protein consensus sequence :	MKLLHLYEASLKRRPKTTNAIMTGALFGIGDVSAQLLFPTSKVNKGYDYKRTARAVIYGSLIFSFIGDKWYKILNNKIYMRNRPQYHWSNMVLRVAVDQLAFAPLGLPFYFTCMSIMEGRSFDVAKLKIKEQWWPTLLTNWAVWPLFQAINFSVVPLQHRLLAVNVVAIFWNTYLSYKNSKVMEKDKVPVHYPPVVE
Functional category(ies) :	Peroxisomal membrane proteins (PMP) PXMP 2/4 family proteins
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	No references found